SCOPe 2.08: Domain d1yy7b1: 1yy7 B:10-87

Lineage for d1yy7b1 (1yy7 B:10-87)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226438] (3 PDB entries)

8. Domain d1yy7b1: 1yy7 B:10-87 [241084]
   Other proteins in same PDB: d1yy7a2, d1yy7b2
   automated match to d4hoja1
   complexed with cit

Details for d1yy7b1

PDB Entry: 1yy7, 2.02 Å

PDB Description: Crystal structure of stringent starvation protein A (SspA), an RNA polymerase-associated transcription factor

PDB Compounds: (B:) stringent starvation protein A

SCOPe Domain Sequences for d1yy7b1:

Sequence; same for both SEQRES and ATOM records:

>d1yy7b1 c.47.1.0 (B:10-87) automated matches {Yersinia pestis [TaxId: 632]}
vmtlfsgptdifshqvrivlaekgvsveieqveadnlpqdlidlnpyrtvptlvdreltl
yesriimeylderfphpp

Timeline for d1yy7b1:

• d1yy7b1 first appeared in SCOPe 2.04
  
• d1yy7b1 appears in SCOPe 2.07