Lineage for d1yvga_ (1yvg A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530194Species Clostridium tetani [TaxId:1513] [224976] (2 PDB entries)
  8. 2530196Domain d1yvga_: 1yvg A: [241073]
    automated match to d2etfa_
    complexed with zn

Details for d1yvga_

PDB Entry: 1yvg (more details), 2.6 Å

PDB Description: Structural analysis of the catalytic domain of tetanus neurotoxin
PDB Compounds: (A:) Tetanus toxin, light chain

SCOPe Domain Sequences for d1yvga_:

Sequence, based on SEQRES records: (download)

>d1yvga_ d.92.1.0 (A:) automated matches {Clostridium tetani [TaxId: 1513]}
pitinnfrysdpvnndtiimmeppyckgldiyykafkitdriwivperyefgtkpedfnp
pssliegaseyydpnylrtdsdkdrflqtmvklfnriknnvagealldkiinaipylgns
yslldkfdtnsnsvsfnlleqdpsgattksamltnliifgpgpvlnknevrgivlrvdnk
nyfpcrdgfgsimqmafcpeyvptfdnvienitsltigkskyfqdpalllmhelihvlhg
lygmqvssheiipskqeiymqhtypisaeelftfggqdanlisidikndlyektlndyka
ianklsqvtscndpnididsykqiyqqkyqfdkdsngqyivnedkfqilynsimygftei
elgkkfniktrlsyfsmnhdpvkipnllddtiyndtegfnieskdlkseykgqnmrvntn
afrnvd

Sequence, based on observed residues (ATOM records): (download)

>d1yvga_ d.92.1.0 (A:) automated matches {Clostridium tetani [TaxId: 1513]}
pitinnfrysdpvnndtiimmeppyckgldiyykafkitdriwivperyefgtkpedfnp
pssaseyydpnylrtdsdkdrflqtmvklfnriknnvagealldkiinaipylgnsysll
dkfdtnsnsvsfnlleqdpsgattksamltnliifgpgpvlnknevrgivlrvdnknyfp
crdgfgsimqmafcpeyvptfdnskyfqdpalllmhelihvlhglygmqvssheipisae
elftfggqdanlisidikndlyektlndykaianklsqvtscndpnididsykqiyqqky
qfdkdsngqyivnedkfqilynsimygfteielgkkfniktrlsyfsmnhdpvkipnlld
dtiyndtegfnieskdlkseykgqnmrvntnafrnvd

SCOPe Domain Coordinates for d1yvga_:

Click to download the PDB-style file with coordinates for d1yvga_.
(The format of our PDB-style files is described here.)

Timeline for d1yvga_: