Lineage for d1yumb_ (1yum B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861098Species Pseudomonas aeruginosa [TaxId:287] [254992] (3 PDB entries)
  8. 2861103Domain d1yumb_: 1yum B: [241068]
    automated match to d1k4kd_
    complexed with cit, ncn

Details for d1yumb_

PDB Entry: 1yum (more details), 1.7 Å

PDB Description: crystal structure of nicotinic acid mononucleotide adenylyltransferase from pseudomonas aeruginosa
PDB Compounds: (B:) 'Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d1yumb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yumb_ c.26.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gkriglfggtfdpvhighmrsavemaeqfaldelrllpnarpphretpqvsaaqrlamve
ravagverltvdprelqrdkpsytidtlesvraelaaddqlfmligwdafcglptwhrwe
alldhchivvlqrpdadseppeslrdllaarsvadpqalkgpggqitfvwqtplavsatq
irallgagrsvrflvpdavlnyieahhlyrap

SCOPe Domain Coordinates for d1yumb_:

Click to download the PDB-style file with coordinates for d1yumb_.
(The format of our PDB-style files is described here.)

Timeline for d1yumb_: