Lineage for d1yr2a2 (1yr2 A:457-738)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871427Species Novosphingobium capsulatum [TaxId:13688] [254989] (1 PDB entry)
  8. 1871428Domain d1yr2a2: 1yr2 A:457-738 [241062]
    Other proteins in same PDB: d1yr2a1
    automated match to d3iula2
    complexed with gol

Details for d1yr2a2

PDB Entry: 1yr2 (more details), 1.8 Å

PDB Description: Structural and Mechanistic Analysis of Two Prolyl Endopeptidases: Role of Inter-Domain Dynamics in Catalysis and Specificity
PDB Compounds: (A:) prolyl oligopeptidase

SCOPe Domain Sequences for d1yr2a2:

Sequence, based on SEQRES records: (download)

>d1yr2a2 c.69.1.0 (A:457-738) automated matches {Novosphingobium capsulatum [TaxId: 13688]}
adfrveqvfypskdgtkvpmfivrrkdakgplptllygyggfnvaltpwfsagfmtwids
ggafalanlrgggeygdawhdagrrdkkqnvfddfiaagewliangvtprhglaieggsn
gglligavtnqrpdlfaaaspavgvmdmlrfdqftagrywvddygypekeadwrvlrrys
pyhnvrsgvdypailvttadtddrvvpghsfkytaalqtaaigpkphlirietraghgsg
kpidkqieetadvqaflahftgltprpwssvdklaaalehhh

Sequence, based on observed residues (ATOM records): (download)

>d1yr2a2 c.69.1.0 (A:457-738) automated matches {Novosphingobium capsulatum [TaxId: 13688]}
adfrveqvfypskdgtkvpmfivrrkdakgplptllygyggfnvaltpwfsagfmtwids
ggafalanlrgggeygdawhdagrrdkkqnvfddfiaagewliangvtprhglaieggsn
gglligavtnqrpdlfaaaspavgvmdmlrfdqftagrywvddygypekeadwrvlrrys
pyhnvrsgvdypailvttadtddrvvpghsfkytaalqtaaigpkphliriepidkqiee
tadvqaflahftgltprpwssvdklaaalehhh

SCOPe Domain Coordinates for d1yr2a2:

Click to download the PDB-style file with coordinates for d1yr2a2.
(The format of our PDB-style files is described here.)

Timeline for d1yr2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yr2a1