Lineage for d1ympb_ (1ymp B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006604Protein automated matches [190101] (7 species)
    not a true protein
  7. 3006651Species Mouse (Mus musculus) [TaxId:10090] [187645] (3 PDB entries)
  8. 3006657Domain d1ympb_: 1ymp B: [241047]
    automated match to d3hg0d_
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1ympb_

PDB Entry: 1ymp (more details), 2.2 Å

PDB Description: The Crystal Structure of a Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve an Ankyrin Fold
PDB Compounds: (B:) Notch 1 protein

SCOPe Domain Sequences for d1ympb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ympb_ d.211.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavnnvda
avvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprdiaqe
rmhhdivrlld

SCOPe Domain Coordinates for d1ympb_:

Click to download the PDB-style file with coordinates for d1ympb_.
(The format of our PDB-style files is described here.)

Timeline for d1ympb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ympa_