SCOPe 2.06: Domain d1yj8c1: 1yj8 C:10-215

Lineage for d1yj8c1 (1yj8 C:10-215)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225359] (3 PDB entries)

8. Domain d1yj8c1: 1yj8 C:10-215 [241036]
   Other proteins in same PDB: d1yj8a2, d1yj8b2, d1yj8c2
   automated match to d2plaa1

Details for d1yj8c1

PDB Entry: 1yj8, 2.85 Å

PDB Description: initial structural analysis of plasmodium falciparum glycerol-3- phosphate dehydrogenase

PDB Compounds: (C:) glycerol-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1yj8c1:

Sequence, based on SEQRES records:

>d1yj8c1 c.2.1.0 (C:10-215) automated matches {Plasmodium falciparum [TaxId: 36329]}
yrnlfdklkdgplkisilgsgnwasaiskvvgtnaknnylfenevrmwirdefvngermv
diinnkhentkylkgvplphnivahsdlasvindadllifivpcqylesvlasikesesi
kiashakaisltkgfivkknqmklcsnyisdflnipcsalsganiamdvamenfseatig
gndkdslviwqrvfdlpyfkincvne

Sequence, based on observed residues (ATOM records):

>d1yj8c1 c.2.1.0 (C:10-215) automated matches {Plasmodium falciparum [TaxId: 36329]}
yrnlfdklkdgplkisilgsgnwasaiskvvgtnaknnylfenevrmwirdefermvdii
nnkhentkylkgvplphnivahsdlasvindadllifivpcqylesvlasikeikiasha
kaisltkgfivkknqmklcsnyisdflnipcsalsganiamdvamenfseatiggndkds
lviwqrvfdlpyfkincvne

Timeline for d1yj8c1:

• d1yj8c1 first appeared in SCOPe 2.04
  
• d1yj8c1 appears in SCOPe 2.05
  
• d1yj8c1 appears in SCOPe 2.07
  
• d1yj8c1 appears in the current release, SCOPe 2.08