Lineage for d1yhuf_ (1yhu F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689546Species Riftia pachyptila [TaxId:6426] [254981] (1 PDB entry)
  8. 2689551Domain d1yhuf_: 1yhu F: [241017]
    automated match to d1x9fc_
    complexed with hem, oxy, zn

Details for d1yhuf_

PDB Entry: 1yhu (more details), 3.15 Å

PDB Description: Crystal structure of Riftia pachyptila C1 hemoglobin reveals novel assembly of 24 subunits.
PDB Compounds: (F:) Giant hemoglobins B chain

SCOPe Domain Sequences for d1yhuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhuf_ a.1.1.0 (F:) automated matches {Riftia pachyptila [TaxId: 6426]}
dyvcgplqrlkvkrqwaeaygsgnsreefghfiwshvfqhspaardmfkrvrgdnihtpa
frahatrvlggldmciallddepvlntqlahlakqhetrgveaahydtvnhavmmgvenv
igsevfdqdawkpclnvitngiqg

SCOPe Domain Coordinates for d1yhuf_:

Click to download the PDB-style file with coordinates for d1yhuf_.
(The format of our PDB-style files is described here.)

Timeline for d1yhuf_: