Lineage for d1x5ba1 (1x5b A:8-157)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727164Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 2727165Protein automated matches [191137] (5 species)
    not a true protein
  7. 2727176Species Human (Homo sapiens) [TaxId:9606] [189251] (7 PDB entries)
  8. 2727187Domain d1x5ba1: 1x5b A:8-157 [240953]
    Other proteins in same PDB: d1x5ba2, d1x5ba3
    automated match to d1elka_

Details for d1x5ba1

PDB Entry: 1x5b (more details)

PDB Description: the solution structure of the vhs domain of human signal transducing adaptor molecule 2
PDB Compounds: (A:) signal transducing adaptor molecule 2

SCOPe Domain Sequences for d1x5ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5ba1 a.118.9.0 (A:8-157) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mplftanpfeqdvekatneynttedwslimdicdkvgstpngakdclkaimkrvnhkvph
valqaltllgacvancgkifhlevcsrdfatevraviknkahpkvceklkslmvewseef
qkdpqfslisatiksmkeegitfppagsqt

SCOPe Domain Coordinates for d1x5ba1:

Click to download the PDB-style file with coordinates for d1x5ba1.
(The format of our PDB-style files is described here.)

Timeline for d1x5ba1: