Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [230763] (2 PDB entries) |
Domain d1x37a_: 1x37 A: [240944] automated match to d1qzma_ |
PDB Entry: 1x37 (more details)
SCOPe Domain Sequences for d1x37a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x37a_ c.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} agyteiekleivkdhllpkqikehglkksnlqlrdqaildiiryytreagvrslerqlaa icrkaakaivaeerkritvteknlqdfigkrifry
Timeline for d1x37a_: