Lineage for d1x37a_ (1x37 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871661Species Bacillus subtilis [TaxId:1423] [230763] (2 PDB entries)
  8. 2871664Domain d1x37a_: 1x37 A: [240944]
    automated match to d1qzma_

Details for d1x37a_

PDB Entry: 1x37 (more details)

PDB Description: structure of bacillus subtilis lon protease ssd domain
PDB Compounds: (A:) ATP-dependent protease La 1

SCOPe Domain Sequences for d1x37a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x37a_ c.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
agyteiekleivkdhllpkqikehglkksnlqlrdqaildiiryytreagvrslerqlaa
icrkaakaivaeerkritvteknlqdfigkrifry

SCOPe Domain Coordinates for d1x37a_:

Click to download the PDB-style file with coordinates for d1x37a_.
(The format of our PDB-style files is described here.)

Timeline for d1x37a_: