Lineage for d1wypa_ (1wyp A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1734996Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1734997Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1735075Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 1735076Protein automated matches [226856] (2 species)
    not a true protein
  7. 1735077Species Human (Homo sapiens) [TaxId:9606] [224978] (26 PDB entries)
  8. 1735125Domain d1wypa_: 1wyp A: [240933]
    automated match to d1ujoa_

Details for d1wypa_

PDB Entry: 1wyp (more details)

PDB Description: Solution structure of the CH domain of human Calponin 1
PDB Compounds: (A:) Calponin 1

SCOPe Domain Sequences for d1wypa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wypa_ a.40.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgnklaqkydhqreqelrewiegvtgrrignnfmdglkdgiilcefinklqpgsv
kkinestqnwhqlenignfikaitkygvkphdifeandlfentnhtqvqstllalasmak
tkgnkvnvgvsgpssg

SCOPe Domain Coordinates for d1wypa_:

Click to download the PDB-style file with coordinates for d1wypa_.
(The format of our PDB-style files is described here.)

Timeline for d1wypa_: