Lineage for d1wupa_ (1wup A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996787Species Serratia marcescens [TaxId:615] [190018] (8 PDB entries)
  8. 2996801Domain d1wupa_: 1wup A: [240910]
    automated match to d4f6ha_
    complexed with acy, zn; mutant

Details for d1wupa_

PDB Entry: 1wup (more details), 3 Å

PDB Description: crystal structure of metallo-beta-lactamase imp-1 mutant (d81e)
PDB Compounds: (A:) beta-lactamase imp-1

SCOPe Domain Sequences for d1wupa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wupa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsestggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglnes

SCOPe Domain Coordinates for d1wupa_:

Click to download the PDB-style file with coordinates for d1wupa_.
(The format of our PDB-style files is described here.)

Timeline for d1wupa_: