Lineage for d1vsyv_ (1vsy V:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1678261Protein automated matches [190144] (7 species)
    not a true protein
  7. 1678282Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries)
  8. 1678515Domain d1vsyv_: 1vsy V: [240804]
    Other proteins in same PDB: d1vsy1_, d1vsy2_, d1vsyf_, d1vsyg_, d1vsyi_, d1vsyj_, d1vsyk_, d1vsyl_, d1vsym_, d1vsyn_, d1vsyt_, d1vsyu_, d1vsyw_, d1vsyx_, d1vsyy_, d1vsyz_
    automated match to d1ryph_

Details for d1vsyv_

PDB Entry: 1vsy (more details), 3 Å

PDB Description: Proteasome Activator Complex
PDB Compounds: (V:) Proteasome component PRE3

SCOPe Domain Sequences for d1vsyv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsyv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
asimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d1vsyv_:

Click to download the PDB-style file with coordinates for d1vsyv_.
(The format of our PDB-style files is described here.)

Timeline for d1vsyv_: