Lineage for d1vsyu_ (1vsy U:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1676715Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1676731Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (66 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1677198Domain d1vsyu_: 1vsy U: [240803]
    Other proteins in same PDB: d1vsya_, d1vsyc_, d1vsyd_, d1vsyh_, d1vsyl_, d1vsyo_, d1vsyq_, d1vsyr_, d1vsyv_, d1vsyz_
    automated match to d1rypg_

Details for d1vsyu_

PDB Entry: 1vsy (more details), 3 Å

PDB Description: Proteasome Activator Complex
PDB Compounds: (U:) Proteasome component C1

SCOPe Domain Sequences for d1vsyu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsyu_ d.153.1.4 (U:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d1vsyu_:

Click to download the PDB-style file with coordinates for d1vsyu_.
(The format of our PDB-style files is described here.)

Timeline for d1vsyu_: