Lineage for d1vsyl_ (1vsy L:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1677317Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1677326Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (62 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1678153Domain d1vsyl_: 1vsy L: [240796]
    Other proteins in same PDB: d1vsy1_, d1vsy2_, d1vsya_, d1vsyc_, d1vsyd_, d1vsyf_, d1vsyg_, d1vsyh_, d1vsyi_, d1vsyj_, d1vsyk_, d1vsym_, d1vsyn_, d1vsyo_, d1vsyq_, d1vsyr_, d1vsyt_, d1vsyu_, d1vsyv_, d1vsyw_, d1vsyx_, d1vsyy_
    automated match to d1rypl_

Details for d1vsyl_

PDB Entry: 1vsy (more details), 3 Å

PDB Description: Proteasome Activator Complex
PDB Compounds: (L:) Proteasome component PRE2

SCOPe Domain Sequences for d1vsyl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsyl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkrvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d1vsyl_:

Click to download the PDB-style file with coordinates for d1vsyl_.
(The format of our PDB-style files is described here.)

Timeline for d1vsyl_: