Lineage for d1spwa_ (1spw A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641213Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2641344Protein automated matches [190785] (6 species)
    not a true protein
  7. 2641351Species Desulfovibrio gigas [TaxId:879] [254890] (1 PDB entry)
  8. 2641352Domain d1spwa_: 1spw A: [240763]
    automated match to d2dsxa_
    mutant

Details for d1spwa_

PDB Entry: 1spw (more details)

PDB Description: solution structure of a loop truncated mutant from d. gigas rubredoxin, nmr
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1spwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spwa_ g.41.5.1 (A:) automated matches {Desulfovibrio gigas [TaxId: 879]}
mdiyvctvcgyeydpafedlpddwacpvcgaskdafekq

SCOPe Domain Coordinates for d1spwa_:

Click to download the PDB-style file with coordinates for d1spwa_.
(The format of our PDB-style files is described here.)

Timeline for d1spwa_: