| Class g: Small proteins [56992] (91 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
| Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
| Protein automated matches [190785] (4 species) not a true protein |
| Species Desulfovibrio gigas [TaxId:879] [254890] (1 PDB entry) |
| Domain d1spwa_: 1spw A: [240763] automated match to d2dsxa_ mutant |
PDB Entry: 1spw (more details)
SCOPe Domain Sequences for d1spwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1spwa_ g.41.5.1 (A:) automated matches {Desulfovibrio gigas [TaxId: 879]}
mdiyvctvcgyeydpafedlpddwacpvcgaskdafekq
Timeline for d1spwa_: