SCOPe 2.06: Domain d1sj6a1: 1sj6 A:1-93

Lineage for d1sj6a1 (1sj6 A:1-93)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.14: SH3BGR (SH3-binding, glutamic acid-rich protein-like) [102446] (2 proteins)
   related to glutaredoxin 1 (GRX1) but lacks both conserved cysteine residues
   automatically mapped to Pfam PF04908

6. Protein automated matches [254429] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254888] (1 PDB entry)

8. Domain d1sj6a1: 1sj6 A:1-93 [240756]
   Other proteins in same PDB: d1sj6a2
   automated match to d1j0fa_

Details for d1sj6a1

PDB Entry: 1sj6

PDB Description: nmr structure and regulated expression in apl cell of human sh3bgrl3

PDB Compounds: (A:) SH3 domain-binding glutamic acid-rich-like protein 3

SCOPe Domain Sequences for d1sj6a1:

Sequence; same for both SEQRES and ATOM records:

>d1sj6a1 c.47.1.14 (A:1-93) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msglrvystsvtgsreiksqqsevtrildgkriqyqlvdisqdnalrdemralagnpkat
ppqivngdqycgdyelfveaveqntlqeflkla

Timeline for d1sj6a1:

• d1sj6a1 first appeared in SCOPe 2.04, called d1sj6a_
  
• d1sj6a1 was called d1sj6a_ in SCOPe 2.05
  
• d1sj6a1 appears in SCOPe 2.07
  
• d1sj6a1 appears in the current release, SCOPe 2.08