SCOPe 2.06: Domain d4olqd1: 4olq D:1-260

Lineage for d4olqd1 (4olq D:1-260)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Hyphomonas neptunium [TaxId:228405] [237710] (2 PDB entries)

8. Domain d4olqd1: 4olq D:1-260 [240715]
   Other proteins in same PDB: d4olqa2, d4olqb2, d4olqd2, d4olqe2, d4olqf2
   automated match to d4olqe_
   complexed with mlt, p6g, peg, pg4, unl

Details for d4olqd1

PDB Entry: 4olq, 2.7 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase family protein from hyphomonas neptunium

PDB Compounds: (D:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d4olqd1:

Sequence; same for both SEQRES and ATOM records:

>d4olqd1 c.14.1.0 (D:1-260) automated matches {Hyphomonas neptunium [TaxId: 228405]}
mtlpirldiaaplaeivlnkperrnalsvdmwaaipglvaeananpdvklilihggdaga
faagadisefetiyatedaakasgqriaqaldaiensekpviaaiegacvgggvslamaa
dlrvagegakfgvtpgklglvypagdtrrllaavgpgatkdilftgriftageakslgli
drlvekgtaleaarvwageiaaisqwsvratkrmirglqtgwtdetpeaqslflngfane
dfkegyrafldkrpakftyr

Timeline for d4olqd1:

• d4olqd1 first appeared in SCOPe 2.04, called d4olqd_
  
• d4olqd1 was called d4olqd_ in SCOPe 2.05
  
• d4olqd1 appears in SCOPe 2.07
  
• d4olqd1 appears in the current release, SCOPe 2.08