Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.8: gamma-Butyrobetaine hydroxylase [89416] (3 proteins) Pfam PF03322 |
Protein Carbapenem synthase, CarC [89417] (2 species) |
Species Pectobacterium carotovorum [TaxId:555] [238281] (1 PDB entry) |
Domain d4oj8c_: 4oj8 C: [240713] automated match to d4oj8b_ complexed with 2tq, akg, fe2, gol |
PDB Entry: 4oj8 (more details), 2.1 Å
SCOPe Domain Sequences for d4oj8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oj8c_ b.82.2.8 (C:) Carbapenem synthase, CarC {Pectobacterium carotovorum [TaxId: 555]} seivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysay gtiveyadekigvgfgyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaei knvkfrgattvcdhalacqempahllrvleeetfevrvlergyyvdvspdgwfkvpvftd lgwvrkmliyfpfdegqpasweprivgftdhetqaffqelgaflkqpryyykhfwedgdl limdnrrvihereefndddivrrlyrgqtad
Timeline for d4oj8c_: