SCOPe 2.05: Domain d4ohja1: 4ohj A:42-133

Lineage for d4ohja1 (4ohj A:42-133)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein automated matches [226992] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225594] (1 PDB entry)

8. Domain d4ohja1: 4ohj A:42-133 [240699]
   Other proteins in same PDB: d4ohja2, d4ohjb2
   automated match to d4ohjb1

Details for d4ohja1

PDB Entry: 4ohj, 1.28 Å

PDB Description: crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus

PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d4ohja1:

Sequence; same for both SEQRES and ATOM records:

>d4ohja1 b.40.2.2 (A:42-133) automated matches {Staphylococcus aureus [TaxId: 1280]}
tndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkgek
vdlntkrtkksqhtsegtyihfqisgvtntek

Timeline for d4ohja1:

• d4ohja1 first appeared in SCOPe 2.04
  
• d4ohja1 appears in SCOPe 2.06
  
• d4ohja1 appears in the current release, SCOPe 2.08