Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (121 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [196590] (3 PDB entries) |
Domain d4oc9a_: 4oc9 A: [240675] automated match to d4oc9e_ complexed with gol, imd, po4 |
PDB Entry: 4oc9 (more details), 2.35 Å
SCOPe Domain Sequences for d4oc9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oc9a_ c.67.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]} fnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnptsd vlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlknf giearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdnt vatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpdp syhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaekv anflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktqlf llaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkqaie s
Timeline for d4oc9a_: