SCOPe 2.06: Domain d4o6rd1: 4o6r D:1-488

Lineage for d4o6rd1 (4o6r D:1-488)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (49 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [236250] (5 PDB entries)

8. Domain d4o6rd1: 4o6r D:1-488 [240668]
   Other proteins in same PDB: d4o6ra2, d4o6rb2, d4o6rc2, d4o6rd2
   automated match to d4o6rb_
   complexed with amp, edo, gol, no3

Details for d4o6rd1

PDB Entry: 4o6r, 1.9 Å

PDB Description: crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia

PDB Compounds: (D:) aldehyde dehydrogenase

SCOPe Domain Sequences for d4o6rd1:

Sequence; same for both SEQRES and ATOM records:

>d4o6rd1 c.82.1.0 (D:1-488) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mqtqlfidgrfvdavdrgtidvlnphdgsvitkiaaataadvdlavdaatrafpawsamp
aaergrlllrladaieantealaqlesldtghpirdsraldvprtaacfryfggmadklq
gsvipvdtgflnyvqrapigvvgqivpwnfplmftswkmgpalaagntvvlkpseitpls
tlrivelmaevgfpagvvnivpgyghtagqrlaehpgvgkiaftgstatgrriveasqgn
lkrvqlelggkganivfddanldaaingaawaifhnqgqaciagsrlvlheriadafler
fvalassirignpldpntemgpltskqhldrvlsyvdvareqggrvltggsapqdpalan
gyyvrptiveakhatdrvaqeevfgpfvtvlrfgsddealaianateyglgsglwtndls
rahrmaaridagmcwincykrvnpgspfggvgksgygremgfeamhdytearsvwvnvdg
nvpphfkr

Timeline for d4o6rd1:

• d4o6rd1 first appeared in SCOPe 2.04, called d4o6rd_
  
• d4o6rd1 was called d4o6rd_ in SCOPe 2.05
  
• d4o6rd1 appears in SCOPe 2.07
  
• d4o6rd1 appears in the current release, SCOPe 2.08