SCOPe 2.07: Domain d4nz0b_: 4nz0 B:

Lineage for d4nz0b_ (4nz0 B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.0: automated matches [227142] (1 protein)
   not a true family

6. Protein automated matches [226844] (11 species)
   not a true protein

7. Species Mengo virus [TaxId:12107] [237860] (3 PDB entries)

8. Domain d4nz0b_: 4nz0 B: [240661]
   automated match to d4nz0a_
   complexed with cl, gol

Details for d4nz0b_

PDB Entry: 4nz0, 2.8 Å

PDB Description: The EMCV 3Dpol structure at 2.8A resolution

PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d4nz0b_:

Sequence; same for both SEQRES and ATOM records:

>d4nz0b_ e.8.1.0 (B:) automated matches {Mengo virus [TaxId: 12107]}
galerlpdgprihvprktalrptvarqvfqpafapavlskfdprtdadvdevafskhtsn
qetlppvfrmvareyanrvfallgrdngrlsvkqaldglegmdpmdkntspglpyttlgm
rrtdvvdwetatlipfaaerlekmnnkdfsdivyqtflkdelrpiekvqaaktrivdvpp
fehcilgrqllgkfaskfqtqpglelgsaigcdpdvhwtafgvamqgfervydvdysnfd
sthsvamfrllaeeffseengfdplvkdyleslaiskhayeekrylitgglpsgcaatsm
lntimnniiiraglyltyknfefddvkvlsygddllvatnyqlnfdrvrtslaktgykit
panktstfplestledvvflkrkfkkegplyrpvmnrealeamlsyyrpgtlsekltsit
mlavhsgkqeydrlfapfrevgvivptfesveyrwrslfw

Timeline for d4nz0b_:

• d4nz0b_ first appeared in SCOPe 2.04
  
• d4nz0b_ appears in SCOPe 2.06
  
• d4nz0b_ appears in the current release, SCOPe 2.08