Lineage for d4nrlb_ (4nrl B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2592010Species Influenza B virus [TaxId:107412] [256374] (3 PDB entries)
  8. 2592017Domain d4nrlb_: 4nrl B: [240653]
    Other proteins in same PDB: d4nrla_, d4nrlc_, d4nrle_
    automated match to d1ti8b1
    complexed with nag; mutant

Details for d4nrlb_

PDB Entry: 4nrl (more details), 2.72 Å

PDB Description: Structure of hemagglutinin with F95Y mutation of influenza virus B/Lee/40
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4nrlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nrlb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza B virus [TaxId: 107412]}
gffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselev
knlqrlsgamnelhdeileldekvddlradtissqielavllsnegiinsedehllaler
klkkmlgpsaveigngcfetkhkcnqtcldriaagtfnagdfslptfdsl

SCOPe Domain Coordinates for d4nrlb_:

Click to download the PDB-style file with coordinates for d4nrlb_.
(The format of our PDB-style files is described here.)

Timeline for d4nrlb_: