Lineage for d4no8t_ (4no8 T:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (16 species)
    not a true protein
  7. 2554883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (108 PDB entries)
  8. 2554927Domain d4no8t_: 4no8 T: [240645]
    Other proteins in same PDB: d4no8a_, d4no8b_, d4no8c_, d4no8d_, d4no8e_, d4no8g_, d4no8h_, d4no8i_, d4no8j_, d4no8k_, d4no8l_, d4no8m_, d4no8n_, d4no8o_, d4no8p_, d4no8q_, d4no8r_, d4no8s_, d4no8u_, d4no8v_, d4no8w_, d4no8x_, d4no8y_, d4no8z_
    automated match to d1irug_
    complexed with 2lv, mg

Details for d4no8t_

PDB Entry: 4no8 (more details), 2.7 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-ketoamide
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4no8t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4no8t_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4no8t_:

Click to download the PDB-style file with coordinates for d4no8t_.
(The format of our PDB-style files is described here.)

Timeline for d4no8t_: