SCOPe 2.08: Domain d4no8t_: 4no8 T:

Lineage for d4no8t_ (4no8 T:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d4no8t_: 4no8 T: [240645]
   Other proteins in same PDB: d4no8a_, d4no8b_, d4no8c1, d4no8c2, d4no8d_, d4no8e_, d4no8g_, d4no8h_, d4no8i_, d4no8j_, d4no8k_, d4no8l_, d4no8m_, d4no8n_, d4no8o_, d4no8p_, d4no8q1, d4no8q2, d4no8r_, d4no8s_, d4no8u_, d4no8v_, d4no8w_, d4no8x_, d4no8y_, d4no8z_
   automated match to d1irug_
   complexed with 2lv, mg

Details for d4no8t_

PDB Entry: 4no8, 2.7 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-ketoamide

PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4no8t_:

Sequence; same for both SEQRES and ATOM records:

>d4no8t_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d4no8t_:

• d4no8t_ first appeared in SCOPe 2.04
  
• d4no8t_ appears in SCOPe 2.07