Lineage for d4nnnt_ (4nnn T:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230713Domain d4nnnt_: 4nnn T: [240639]
    Other proteins in same PDB: d4nnna_, d4nnnb_, d4nnnc_, d4nnnd_, d4nnne_, d4nnng_, d4nnnh_, d4nnni_, d4nnnj_, d4nnnk_, d4nnnl_, d4nnnm_, d4nnnn_, d4nnno_, d4nnnp_, d4nnnq_, d4nnnr_, d4nnns_, d4nnnu_, d4nnnv_, d4nnnw_, d4nnnx_, d4nnny_, d4nnnz_
    automated match to d1irug_
    complexed with ald, mg

Details for d4nnnt_

PDB Entry: 4nnn (more details), 2.5 Å

PDB Description: yCP in complex with MG132
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4nnnt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnnt_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4nnnt_:

Click to download the PDB-style file with coordinates for d4nnnt_.
(The format of our PDB-style files is described here.)

Timeline for d4nnnt_: