Lineage for d4nnnf_ (4nnn F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1937404Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1937405Protein automated matches [190509] (10 species)
    not a true protein
  7. 1937446Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (9 PDB entries)
  8. 1937463Domain d4nnnf_: 4nnn F: [240638]
    Other proteins in same PDB: d4nnna_, d4nnnb_, d4nnnc_, d4nnnd_, d4nnne_, d4nnng_, d4nnnh_, d4nnni_, d4nnnj_, d4nnnk_, d4nnnl_, d4nnnm_, d4nnnn_, d4nnno_, d4nnnp_, d4nnnq_, d4nnnr_, d4nnns_, d4nnnu_, d4nnnv_, d4nnnw_, d4nnnx_, d4nnny_, d4nnnz_
    automated match to d1irug_
    complexed with ald, mg

Details for d4nnnf_

PDB Entry: 4nnn (more details), 2.5 Å

PDB Description: yCP in complex with MG132
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4nnnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnnf_ d.153.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4nnnf_:

Click to download the PDB-style file with coordinates for d4nnnf_.
(The format of our PDB-style files is described here.)

Timeline for d4nnnf_: