SCOPe 2.08: Domain d4nf6b_: 4nf6 B:

Lineage for d4nf6b_ (4nf6 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)

8. Domain d4nf6b_: 4nf6 B: [240625]
   Other proteins in same PDB: d4nf6a_
   automated match to d4nf4b_
   complexed with 2jl, gly

Details for d4nf6b_

PDB Entry: 4nf6, 2.1 Å

PDB Description: crystal structure of glun1/glun2a ligand-binding domain in complex with glycine and ppda

PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 2A

SCOPe Domain Sequences for d4nf6b_:

Sequence, based on SEQRES records:

>d4nf6b_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfci
dilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersev
vdfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypy
mhqymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattg
ygialqkgspwkrqidlallqfvgdgemeeletlwltgic

Sequence, based on observed residues (ATOM records):

>d4nf6b_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddnhlsivtleeapfvivedidtetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
qymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgyg
ialqkgspwkrqidlallqfvgdgemeeletlwltgic

Timeline for d4nf6b_:

• d4nf6b_ first appeared in SCOPe 2.04
  
• d4nf6b_ appears in SCOPe 2.07