SCOPe 2.08: Domain d4n63b_: 4n63 B:

Lineage for d4n63b_ (4n63 B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Influenza A virus [TaxId:1332244] [256359] (11 PDB entries)

8. Domain d4n63b_: 4n63 B: [240571]
   Other proteins in same PDB: d4n63a_, d4n63c_
   automated match to d4n5zb_
   complexed with nag

Details for d4n63b_

PDB Entry: 4n63, 2.75 Å

PDB Description: crystal structure of hemagglutinin from an h7n9 influenza virus in complex with an o-linked glycan receptor

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4n63b_:

Sequence; same for both SEQRES and ATOM records:

>d4n63b_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 1332244]}
gaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqf
elidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervk
rqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq

Timeline for d4n63b_:

• d4n63b_ first appeared in SCOPe 2.04
  
• d4n63b_ appears in SCOPe 2.07