Lineage for d4n61b_ (4n61 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041574Species Influenza A virus [TaxId:1332244] [256359] (11 PDB entries)
  8. 3041589Domain d4n61b_: 4n61 B: [240567]
    Other proteins in same PDB: d4n61a_, d4n61c_
    automated match to d4n5zb_
    complexed with nag, sia

Details for d4n61b_

PDB Entry: 4n61 (more details), 2.6 Å

PDB Description: crystal structure of hemagglutinin from an h7n9 influenza virus in complex with lsta, extended soaking
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4n61b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n61b_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 1332244]}
gaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqf
elidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervk
rqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq

SCOPe Domain Coordinates for d4n61b_:

Click to download the PDB-style file with coordinates for d4n61b_.
(The format of our PDB-style files is described here.)

Timeline for d4n61b_: