Lineage for d4mhip_ (4mhi P:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267108Domain d4mhip_: 4mhi P: [240543]
    Other proteins in same PDB: d4mhia1, d4mhia2, d4mhic1, d4mhic2, d4mhie1, d4mhie2, d4mhig1, d4mhig2, d4mhii1, d4mhii2, d4mhik1, d4mhik2, d4mhim1, d4mhim2, d4mhio1, d4mhio2, d4mhiq1, d4mhiq2
    automated match to d4n5zb_
    complexed with nag

Details for d4mhip_

PDB Entry: 4mhi (more details), 2.6 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin from a/goose/guangdong/1/96
PDB Compounds: (P:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4mhip_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mhip_ h.3.1.1 (P:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkqmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvkngtydypqyseearlnreei

SCOPe Domain Coordinates for d4mhip_:

Click to download the PDB-style file with coordinates for d4mhip_.
(The format of our PDB-style files is described here.)

Timeline for d4mhip_: