![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
![]() | Protein automated matches [190914] (14 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228531] (5 PDB entries) |
![]() | Domain d4m75m_: 4m75 M: [240523] Other proteins in same PDB: d4m75g2, d4m75n2 automated match to d3bw1a_ protein/RNA complex; complexed with cl |
PDB Entry: 4m75 (more details), 2.95 Å
SCOPe Domain Sequences for d4m75m_:
Sequence, based on SEQRES records: (download)
>d4m75m_ b.38.1.0 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} dlakykdskirvklmggklvigvlkgydqlmnlvlddtveymsnpddenntelisknark lgltvirgtilvslss
>d4m75m_ b.38.1.0 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} dlakykdskirvklmggklvigvlkgydqlmnlvlddtveymsarklgltvirgtilvsl ss
Timeline for d4m75m_: