SCOPe 2.07: Domain d4lvhi2: 4lvh I:111-210

Lineage for d4lvhi2 (4lvh I:111-210)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d4lvhi2: 4lvh I:111-210 [240505]
   Other proteins in same PDB: d4lvhc1, d4lvhf1, d4lvhi1, d4lvhl1
   automated match to d4lvhc2
   complexed with ca

Details for d4lvhi2

PDB Entry: 4lvh, 2.8 Å

PDB Description: insight into highly conserved h1 subtype-specific epitopes in influenza virus hemagglutinin

PDB Compounds: (I:) monoclonal antibody l-chain

SCOPe Domain Sequences for d4lvhi2:

Sequence; same for both SEQRES and ATOM records:

>d4lvhi2 b.1.1.2 (I:111-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkinvkwkidgserqngvlnswtdqds
kdstysmsstltldeyerhnsytceathktstspivksfn

Timeline for d4lvhi2:

• d4lvhi2 first appeared in SCOPe 2.04
  
• d4lvhi2 appears in SCOPe 2.06
  
• d4lvhi2 appears in the current release, SCOPe 2.08