Lineage for d4lvhi2 (4lvh I:111-210)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518534Domain d4lvhi2: 4lvh I:111-210 [240505]
    Other proteins in same PDB: d4lvhc1, d4lvhf1, d4lvhi1, d4lvhl1
    automated match to d4lvhc2
    complexed with ca

Details for d4lvhi2

PDB Entry: 4lvh (more details), 2.8 Å

PDB Description: insight into highly conserved h1 subtype-specific epitopes in influenza virus hemagglutinin
PDB Compounds: (I:) monoclonal antibody l-chain

SCOPe Domain Sequences for d4lvhi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lvhi2 b.1.1.2 (I:111-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkinvkwkidgserqngvlnswtdqds
kdstysmsstltldeyerhnsytceathktstspivksfn

SCOPe Domain Coordinates for d4lvhi2:

Click to download the PDB-style file with coordinates for d4lvhi2.
(The format of our PDB-style files is described here.)

Timeline for d4lvhi2: