Lineage for d4lkjb_ (4lkj B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2592030Protein automated matches [254646] (28 species)
    not a true protein
  7. 2592219Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 2592292Domain d4lkjb_: 4lkj B: [240481]
    Other proteins in same PDB: d4lkja_
    automated match to d1qfub_
    complexed with nag; mutant

Details for d4lkjb_

PDB Entry: 4lkj (more details), 2.8 Å

PDB Description: The structure of hemagglutinin L226Q mutant (H3 numbering) from a avian-origin H7N9 influenza virus (A/Anhui/1/2013) in complex with avian receptor analog 3'SLNLN
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4lkjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lkjb_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
qfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn

SCOPe Domain Coordinates for d4lkjb_:

Click to download the PDB-style file with coordinates for d4lkjb_.
(The format of our PDB-style files is described here.)

Timeline for d4lkjb_: