Lineage for d4l4vc1 (4l4v C:0-178)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1898167Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1898168Protein automated matches [226842] (4 species)
    not a true protein
  7. 1898181Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)
  8. 1898184Domain d4l4vc1: 4l4v C:0-178 [240473]
    Other proteins in same PDB: d4l4va2, d4l4vb_, d4l4vc2, d4l4vd1, d4l4vd2, d4l4ve1, d4l4ve2, d4l4vf_, d4l4vg1, d4l4vg2, d4l4vh1, d4l4vh2
    automated match to d4l4tc1
    complexed with 1vy, gol

Details for d4l4vc1

PDB Entry: 4l4v (more details), 1.9 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-RL-6-Me-7-OH
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4l4vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l4vc1 d.19.1.0 (C:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhw
erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf
lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4l4vc1:

Click to download the PDB-style file with coordinates for d4l4vc1.
(The format of our PDB-style files is described here.)

Timeline for d4l4vc1: