Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries) |
Domain d4l4vc1: 4l4v C:0-178 [240473] Other proteins in same PDB: d4l4va2, d4l4vb_, d4l4vc2, d4l4vd1, d4l4vd2, d4l4ve1, d4l4ve2, d4l4vf_, d4l4vg1, d4l4vg2, d4l4vh1, d4l4vh2 automated match to d4l4tc1 complexed with 1vy, gol |
PDB Entry: 4l4v (more details), 1.9 Å
SCOPe Domain Sequences for d4l4vc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l4vc1 d.19.1.0 (C:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhw erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4l4vc1: