SCOPe 2.04: Domain d4kthb_: 4kth B:

Lineage for d4kthb_ (4kth B:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (7 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)

8. Domain d4kthb_: 4kth B: [240456]
   Other proteins in same PDB: d4ktha_, d4kthc_, d4kthe_
   automated match to d4n5zb_
   complexed with nag

Details for d4kthb_

PDB Entry: 4kth, 2.6 Å

PDB Description: structure of a/hubei/1/2010 h5 ha

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4kthb_:

Sequence; same for both SEQRES and ATOM records:

>d4kthb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
ieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgre
fnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvrnlydkvrlqlkdn
akelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis

Timeline for d4kthb_:

• d4kthb_ is new in SCOPe 2.04-stable
  
• d4kthb_ appears in SCOPe 2.05
  
• d4kthb_ appears in the current release, SCOPe 2.08