SCOPe 2.06: Domain d4kaxb_: 4kax B:

Lineage for d4kaxb_ (4kax B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein automated matches [190063] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187187] (8 PDB entries)

8. Domain d4kaxb_: 4kax B: [240406]
   Other proteins in same PDB: d4kaxa1, d4kaxa2, d4kaxa3
   automated match to d1fgya_
   complexed with 4ip, cit, gol, gtp, k, mg

Details for d4kaxb_

PDB Entry: 4kax, 1.85 Å

PDB Description: crystal structure of the grp1 ph domain in complex with arf6-gtp

PDB Compounds: (B:) Cytohesin-3

SCOPe Domain Sequences for d4kaxb_:

Sequence; same for both SEQRES and ATOM records:

>d4kaxb_ b.55.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gndlthtffnpdregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenls
irevedprkpncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmks
ikasisrdpfydmlatrkrrian

Timeline for d4kaxb_:

• d4kaxb_ first appeared in SCOPe 2.04
  
• d4kaxb_ appears in SCOPe 2.05
  
• d4kaxb_ appears in SCOPe 2.07
  
• d4kaxb_ appears in the current release, SCOPe 2.08