Class a: All alpha proteins [46456] (289 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [48555] (93 PDB entries) Uniprot P02768 29-596 |
Domain d4k71a3: 4k71 A:389-585 [240397] Other proteins in same PDB: d4k71b1, d4k71b2, d4k71c_, d4k71e1, d4k71e2, d4k71f_ automated match to d4emxa3 complexed with so4 |
PDB Entry: 4k71 (more details), 2.4 Å
SCOPe Domain Sequences for d4k71a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k71a3 a.126.1.1 (A:389-585) Serum albumin {Human (Homo sapiens) [TaxId: 9606]} kqncelfeqlgeykfqnallvrytkkvpqmsaptlvevsrnlgkvgskcckhpeakrmpc aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnagtft fhadictlsekerqikkqtalvelvkhkpkatkeqlkaamddfaafvekcckaddketcf aeegkklvaasqaalgl
Timeline for d4k71a3: