Lineage for d4k71a3 (4k71 A:389-585)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730254Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2730255Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2730256Species Human (Homo sapiens) [TaxId:9606] [48555] (96 PDB entries)
    Uniprot P02768 29-596
  8. 2730414Domain d4k71a3: 4k71 A:389-585 [240397]
    Other proteins in same PDB: d4k71b1, d4k71b2, d4k71c_, d4k71e1, d4k71e2, d4k71f_
    automated match to d4emxa3
    complexed with so4

Details for d4k71a3

PDB Entry: 4k71 (more details), 2.4 Å

PDB Description: Crystal structure of a high affinity Human Serum Albumin variant bound to the Neonatal Fc Receptor
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4k71a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k71a3 a.126.1.1 (A:389-585) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqmsaptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnagtft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkaamddfaafvekcckaddketcf
aeegkklvaasqaalgl

SCOPe Domain Coordinates for d4k71a3:

Click to download the PDB-style file with coordinates for d4k71a3.
(The format of our PDB-style files is described here.)

Timeline for d4k71a3: