Lineage for d4jugl_ (4jug L:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041241Domain d4jugl_: 4jug L: [240360]
    Other proteins in same PDB: d4juga1, d4juga2, d4jugc1, d4jugc2, d4juge1, d4juge2, d4jugg1, d4jugg2, d4jugi1, d4jugi2, d4jugk1, d4jugk2
    automated match to d1rd8b_
    mutant

Details for d4jugl_

PDB Entry: 4jug (more details), 2.7 Å

PDB Description: crystal structure of 1918 pandemic influenza virus hemagglutinin mutant d225g
PDB Compounds: (L:) Hemagglutinin

SCOPe Domain Sequences for d4jugl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jugl_ h.3.1.1 (L:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkysee

SCOPe Domain Coordinates for d4jugl_:

Click to download the PDB-style file with coordinates for d4jugl_.
(The format of our PDB-style files is described here.)

Timeline for d4jugl_: