Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (7 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries) |
Domain d4ju0l_: 4ju0 L: [240354] Other proteins in same PDB: d4ju0a_, d4ju0c_, d4ju0e_, d4ju0g_, d4ju0i_, d4ju0k_ automated match to d1qfub_ complexed with nag, sia; mutant |
PDB Entry: 4ju0 (more details), 2.91 Å
SCOPe Domain Sequences for d4ju0l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ju0l_ h.3.1.1 (L:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek vrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
Timeline for d4ju0l_: