Lineage for d4jaqb1 (4jaq B:2-211)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881785Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1881786Protein automated matches [196909] (52 species)
    not a true protein
  7. 1882076Species Mycobacterium tuberculosis [TaxId:1773] [196910] (11 PDB entries)
  8. 1882099Domain d4jaqb1: 4jaq B:2-211 [240308]
    complexed with 14v, coa, plm

Details for d4jaqb1

PDB Entry: 4jaq (more details), 1.73 Å

PDB Description: Crystal Structure of Mycobacterium tuberculosis PKS11 Reveals Intermediates in the Synthesis of Methyl-branched Alkylpyrones
PDB Compounds: (B:) Alpha-pyrone synthesis polyketide synthase-like Pks11

SCOPe Domain Sequences for d4jaqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jaqb1 c.95.1.0 (B:2-211) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sviagvfgalpphrysqseitdsfvefpglkeheeiirrlhaaakvngrhlvlplqqyps
ltdfgdaneifiekavdlgveallgalddanlrpsdidmiatatvtgvavpsldariagr
lglrpdvrrmplfglgcvagaagvarlrdylrgapddvavlvsvelcsltypavkptvss
lvgtalfgdgaaavvavgdrraeqvraggp

SCOPe Domain Coordinates for d4jaqb1:

Click to download the PDB-style file with coordinates for d4jaqb1.
(The format of our PDB-style files is described here.)

Timeline for d4jaqb1: