Lineage for d1rin.1 (1rin A:,B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1307105Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1307253Protein Legume lectin [49904] (23 species)
  7. 1307416Species Pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 1307427Domain d1rin.1: 1rin A:,B: [24030]
    complexed with ca, man, mn

Details for d1rin.1

PDB Entry: 1rin (more details), 2.6 Å

PDB Description: x-ray crystal structure of a pea lectin-trimannoside complex at 2.6 angstroms resolution
PDB Compounds: (A:) pea lectin, (B:) pea lectin

SCOPe Domain Sequences for d1rin.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1rin.1 b.29.1.1 (A:,B:) Legume lectin {Pea (Pisum sativum) [TaxId: 3888]}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttetvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
Xvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels

SCOPe Domain Coordinates for d1rin.1:

Click to download the PDB-style file with coordinates for d1rin.1.
(The format of our PDB-style files is described here.)

Timeline for d1rin.1: