SCOPe 2.04: Domain d4j0ea1: 4j0e A:1-198

Lineage for d4j0ea1 (4j0e A:1-198)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [237812] (2 PDB entries)

8. Domain d4j0ea1: 4j0e A:1-198 [240274]
   Other proteins in same PDB: d4j0ea2, d4j0eb2
   automated match to d4j0eb1

Details for d4j0ea1

PDB Entry: 4j0e, 1.6 Å

PDB Description: Crystal structure of 3-hydroxyacyl-CoA dehydrogenase from Caenorhadbitis elegans in P1 space group

PDB Compounds: (A:) Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1

SCOPe Domain Sequences for d4j0ea1:

Sequence; same for both SEQRES and ATOM records:

>d4j0ea1 c.2.1.0 (A:1-198) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mftakcamqnirnvaivgsgqmgsgiaqvtassgfnvmladvnkkaldramkaisqsvth
lskkqkgtdkeksdfvtltmsriktcnnvstavadadliieaaienidlkrgifaqieqs
ckkdsilttntssflledvakglqdktrfgglhffnpvpvmkllevirsddtsdetyatl
ikfgtavgkttvackdsp

Timeline for d4j0ea1:

• d4j0ea1 is new in SCOPe 2.04-stable
  
• d4j0ea1 appears in SCOPe 2.05
  
• d4j0ea1 appears in the current release, SCOPe 2.08