Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Lodderomyces elongisporus [TaxId:379508] [234908] (1 PDB entry) |
Domain d4ivfg2: 4ivf G:95-224 [240267] Other proteins in same PDB: d4ivfa1, d4ivfa2, d4ivfb1, d4ivfc1, d4ivfc3, d4ivfd1, d4ivfe1, d4ivfe3, d4ivff1, d4ivff3, d4ivfg1, d4ivfg3, d4ivfh1 automated match to d4ivfb2 complexed with cit, gsh |
PDB Entry: 4ivf (more details), 2.2 Å
SCOPe Domain Sequences for d4ivfg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ivfg2 a.45.1.0 (G:95-224) automated matches {Lodderomyces elongisporus [TaxId: 379508]} fsypagtaeyyktleylifqvaengpiqgqanhfvfaakekvpyginryitdtkriygvf edilsrnkandskylvgdrytvadfallgwayrlsrleidinqwpllgkwydsllklpav qkgfevppkn
Timeline for d4ivfg2: