Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Clostridium scindens [TaxId:29347] [234900] (2 PDB entries) |
Domain d4is3c_: 4is3 C: [240253] automated match to d4is3a_ complexed with act, nad, unl |
PDB Entry: 4is3 (more details), 2 Å
SCOPe Domain Sequences for d4is3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4is3c_ c.2.1.0 (C:) automated matches {Clostridium scindens [TaxId: 29347]} gmnlvqdkvtiitggtrgigfaaakifidngakvsifgetqeevdtalaqlkelypeeev lgfapdltsrdavmaavgqvaqkygrldvminnagitsnnvfsrvseeefkhimdinvtg vfngawcayqcmkdakkgviintasvtgifgslsgvgypaskasviglthglgreiirkn irvvgvapgvvntdmtngnppeimegylkalpmkrmlepeeianvylflasdlasgitat tvsvdgayrp
Timeline for d4is3c_: