Lineage for d4is3c_ (4is3 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830996Species Clostridium scindens [TaxId:29347] [234900] (2 PDB entries)
  8. 1831000Domain d4is3c_: 4is3 C: [240253]
    automated match to d4is3a_
    complexed with act, nad, unl

Details for d4is3c_

PDB Entry: 4is3 (more details), 2 Å

PDB Description: crystal structure of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 in complex with a putative nad(+)-oh- adduct at 2.0 a resolution
PDB Compounds: (C:) Bile acid 3-alpha hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d4is3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4is3c_ c.2.1.0 (C:) automated matches {Clostridium scindens [TaxId: 29347]}
gmnlvqdkvtiitggtrgigfaaakifidngakvsifgetqeevdtalaqlkelypeeev
lgfapdltsrdavmaavgqvaqkygrldvminnagitsnnvfsrvseeefkhimdinvtg
vfngawcayqcmkdakkgviintasvtgifgslsgvgypaskasviglthglgreiirkn
irvvgvapgvvntdmtngnppeimegylkalpmkrmlepeeianvylflasdlasgitat
tvsvdgayrp

SCOPe Domain Coordinates for d4is3c_:

Click to download the PDB-style file with coordinates for d4is3c_.
(The format of our PDB-style files is described here.)

Timeline for d4is3c_: