SCOPe 2.04: Domain d4iosh_: 4ios H:

Lineage for d4iosh_ (4ios H:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
   automatically mapped to Pfam PF08932

6. Protein automated matches [232461] (1 species)
   not a true protein

7. Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries)

8. Domain d4iosh_: 4ios H: [240251]
   Other proteins in same PDB: d4iosd_, d4iose_, d4iosf_, d4iosg_
   automated match to d3hg0a1
   complexed with gol

Details for d4iosh_

PDB Entry: 4ios, 2.4 Å

PDB Description: structure of phage tp901-1 rbp (orf49) in complex with nanobody 11.

PDB Compounds: (H:) bpp

SCOPe Domain Sequences for d4iosh_:

Sequence; same for both SEQRES and ATOM records:

>d4iosh_ b.21.1.3 (H:) automated matches {Lactococcus phage [TaxId: 35345]}
tkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvg
hmvggwnafhidipssgvcqwfgptassgtprgtgtypid

Timeline for d4iosh_:

• d4iosh_ is new in SCOPe 2.04-stable
  
• d4iosh_ appears in SCOPe 2.05
  
• d4iosh_ appears in the current release, SCOPe 2.08