Lineage for d4intf_ (4int F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (16 species)
    not a true protein
  7. 2554848Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)
  8. 2554857Domain d4intf_: 4int F: [240246]
    Other proteins in same PDB: d4inta_, d4intb_, d4intc_, d4intd_, d4inte_, d4intg_, d4inth_, d4inti_, d4intj_, d4intk_, d4intl_, d4intm_, d4intn_, d4into_, d4intp_, d4intq_, d4intr_, d4ints_, d4intu_, d4intv_, d4intw_, d4intx_, d4inty_, d4intz_
    automated match to d1irug_
    complexed with 1g5

Details for d4intf_

PDB Entry: 4int (more details), 2.9 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU122
PDB Compounds: (F:) Proteasome component C1

SCOPe Domain Sequences for d4intf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4intf_ d.153.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d4intf_:

Click to download the PDB-style file with coordinates for d4intf_.
(The format of our PDB-style files is described here.)

Timeline for d4intf_: