SCOPe 2.04: Domain d4hn8d1: 4hn8 D:8-154

Lineage for d4hn8d1 (4hn8 D:8-154)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (67 species)
   not a true protein

7. Species Pseudomonas mendocina [TaxId:399739] [234658] (1 PDB entry)

8. Domain d4hn8d1: 4hn8 D:8-154 [240214]
   Other proteins in same PDB: d4hn8a2, d4hn8b2, d4hn8c2, d4hn8d2, d4hn8e1, d4hn8f1, d4hn8g1, d4hn8h2
   automated match to d4hn8a1
   complexed with gol

Details for d4hn8d1

PDB Entry: 4hn8, 2.2 Å

PDB Description: crystal structure of a putative d-glucarate dehydratase from pseudomonas mendocina ymp

PDB Compounds: (D:) d-glucarate dehydratase

SCOPe Domain Sequences for d4hn8d1:

Sequence, based on SEQRES records:

>d4hn8d1 d.54.1.0 (D:8-154) automated matches {Pseudomonas mendocina [TaxId: 399739]}
stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
ercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaqpheinlrld
nvitaveaalldllgqhlevpvaellg

Sequence, based on observed residues (ATOM records):

>d4hn8d1 d.54.1.0 (D:8-154) automated matches {Pseudomonas mendocina [TaxId: 399739]}
stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
ercrervigqsvgrynrvlndlrqaialrldnvitaveaalldllgqhlevpvaellg

Timeline for d4hn8d1:

• d4hn8d1 is new in SCOPe 2.04-stable
  
• d4hn8d1 appears in SCOPe 2.05
  
• d4hn8d1 appears in the current release, SCOPe 2.08